PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0450s0110.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB
Protein Properties Length: 223aa    MW: 25785.6 Da    PI: 6.5226
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0450s0110.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.66.7e-09752346
                            SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
         Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                            +W+ +Ed+++ +a  +++ +   +W++I+++++ g++  +++ ++ +
  SapurV1A.0450s0110.1.p  7 SWSRQEDKQFEQALVLFPEEtpnRWEKISSYVP-GKSWREVRKHYED 52
                            7*****************99*************.***********76 PP

2Myb_DNA-binding43.95.6e-14105149347
                             SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
         Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                             +WT+eE+ l++ + +++G+g+W++I+r     Rt+ q+ s+ qky
  SapurV1A.0450s0110.1.p 105 PWTEEEHRLFLIGLQKYGKGDWRSISRNAVVSRTPTQVASHAQKY 149
                             8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.608158IPR017930Myb domain
SMARTSM007174.3E-11456IPR001005SANT/Myb domain
SuperFamilySSF466892.54E-12662IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-5754IPR009057Homeodomain-like
PfamPF002496.0E-8753IPR001005SANT/Myb domain
CDDcd001676.29E-8754No hitNo description
PROSITE profilePS5129419.52198154IPR017930Myb domain
SuperFamilySSF466891.17E-1699155IPR009057Homeodomain-like
SMARTSM007171.2E-10102152IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-13102149IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-17102152IPR006447Myb domain, plants
CDDcd001676.43E-9105150No hitNo description
PfamPF002491.4E-11105149IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MSSHFSSWSR QEDKQFEQAL VLFPEETPNR WEKISSYVPG KSWREVRKHY EDLVHDVWEI  60
DSGRVEVPIY DQDELWGEST ASLGSAAAEF RGKEREHTER RKGTPWTEEE HRLFLIGLQK  120
YGKGDWRSIS RNAVVSRTPT QVASHAQKYF LRRNSVKKEK KRSSIHDITA ATATHPMARA  180
DYDPDWNFEL VEPSVDEPMS RPASFFLDQG NPPPYQGFGF PV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-138701173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011006061.11e-137PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H76e-54DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLB9GI071e-118B9GI07_POPTR; Uncharacterized protein
STRINGPOPTR_0001s22660.11e-91(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-75MYB family protein